PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009115935.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB_related
Protein Properties Length: 1643aa    MW: 180150 Da    PI: 7.1014
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009115935.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.63.7e-10855896346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +WT eE e ++   +++G++ +k+Ia+ +   +t  +c+++++k
   XP_009115935.1 855 PWTSEEKETFLSMLAMHGKD-FKKIASFLT-QKTTADCIDYYYK 896
                      8*****************99.********9.9**********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.69E-14838899IPR009057Homeodomain-like
PROSITE profilePS5129315.171851902IPR017884SANT domain
SMARTSM007171.0E-8852900IPR001005SANT/Myb domain
PfamPF002492.1E-8854896IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.4E-7855901IPR009057Homeodomain-like
CDDcd001672.56E-7855897No hitNo description
PROSITE profilePS5129310.83210651116IPR017884SANT domain
SMARTSM007172.0E-510661114IPR001005SANT/Myb domain
SuperFamilySSF466896.16E-810691116IPR009057Homeodomain-like
CDDcd001675.61E-510701111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1643 aa     Download sequence    Send to blast
MPPQDHSSWD RKDLLRQRKH ERPSEPPFDP PPFRWRDSPS SSSSSHREFS RWGGSADFRR  60
PSSHGKQGGR YQFVEESSHG YTSSRSSARM FENDYYRPSA PRGDWRYTRN CRDDRVPLSQ  120
KDWRSNTWEM NNGSYRAFDR PCGVRNGRRS VEERPPPASD THTTVVNSWE QANSAQQMDI  180
ELCTPSRTVR SKNEQKFLDQ RQSLPLDPHS EGLGLLDRPS SVNSYENKEC SPAKQSNGLM  240
HGRRLAGDNA SDPPILNAEI EGTGNQILLK DMHDTKLHEV SDLDGVRENG KENSLGAIGK  300
LPVWTRSGNF ASQSSGFSHS SSLKSLGAVD SSDGKHKILP KTVAVTQSSS GDVTACPKTT  360
VSEEMSSRKK QRLGWGEGLA KYENKKVDVN TTEDGTDLLE NSAEEIHSLN KNTADKSPTA  420
ANAPDYGSPT TPSSVACNSS PDKSSAKAAI GASDVSNVCR SPSPVSSIHL ERLPINIEEL  480
DNISMERVGC LLSELLGTDD PGTGDSSSVQ LTSMKKLLAW KGDILKAVEM AESEIDLLES  540
KHKALKLESA RQCRVVGPNS DLSEGDENVQ QEASCVLGLK AVASSVAETL VRDPVHQAVS  600
AKDPVEIFED SCREVSALPQ FIPTFGSNED ILPIPSTKAD SNQETIDLSS AYDSMVSDED  660
LLCAKLLSTN KIYASESSQV FNKLLPRDFS SFDDSRFPGR CQRQFDSHVK EKIAERIELL  720
RAREKILLLR FKAFQLAWKK DLRQLTSAKY QPKANKKTEV FPYAKNGGHL KLSQPVRLRL  780
SSSAQRRDSV ASTTELVSYM KKLLKNTRLK PLRDILRMPA MILDEKERVR SRFISSNGLI  840
EDPCDVEKER TMINPWTSEE KETFLSMLAM HGKDFKKIAS FLTQKTTADC IDYYYKNHKS  900
DCFAKIKKQR SFGKEGKHTY MLAPTKKWKR EMGAASLDIL GAVSIIAANA GKVASTRQTS  960
SKRITLRGCS SSSSLQHDGN YSEGYSHSFD FPRKRTLGAD VVAVGPLSSE QINSCLRTSV  1020
KSREGCNDHL KFAPAAKKPR ISHATHNENS NEDDDSCSEE SCGETGPIHW TDAERSAFIQ  1080
GFSLFGKNFA SLSRFVRTRS PDQCRVFFSK VRKCLGLECI QSGSGNVSAS ASVDNANEGG  1140
GSDLEGPCAT ESNSGICNNG VSAKIGLNTL TSPLNMNQEG ANHSGFENVE AGLSRSEQEN  1200
GLALLRLKDG TNLVNTANIN GDSEPCRDLV DINTGESHCQ AADQMNSNDL LSKDIDEGNL  1260
TSVAAEKIKS SDQLSMEIDE GNLTPIAVSS DPLYCGSIVL SNNIVEKGSG CEGAALPKQS  1320
SKMQDGVMQA ANRTRNSGLE AEAAPSSFRY PECLHHVPIE EDLVGVSVPQ GDSNCHTEPE  1380
LPNPLVAQTN NRGWQFSEVN LDLDKRSQVL GHVKPEQNGQ LHVTSTGSCQ IPWISFTQDP  1440
SRIIRSKSDL IVKAQRTGEA FSLKKCTSSA TKPLTVFQKD GRSGHSRSHS FSLSDAKRLD  1500
KNGDVKLFGT VLTADENGSK QKHNPGGSIR PSSILSRDHE TGHQYINQQH LQNVPITSYG  1560
FWDGNRIQTG LTSLPESAKL VASYPEALTT HQKQQVVSTK EIQLDVSGIL SFGKQIEDRA  1620
EVSSGKDKGK IGGEVNGVAE AAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C4e-18812903393NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D4e-18812903393NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009115935.10.0PREDICTED: uncharacterized protein LOC103841164
TrEMBLM4CRS30.0M4CRS3_BRARP; Uncharacterized protein
STRINGBra006915.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52602744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.10.0MYB family protein